PDB entry 1xc9

View 1xc9 on RCSB PDB site
Description: Structure of a high-fidelity polymerase bound to a benzo[a]pyrene adduct that blocks replication
Class: transferase/DNA
Keywords: DNA polymerase I; DNA replication; klenow fragment; benzo[a]pyrene; benzopyrene; DNA lesion; translation replication, TRANSFERASE/DNA COMPLEX
Deposited on 2004-09-01, released 2004-12-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.221
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA polymerase I
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1xc9a1, d1xc9a2
  • Chain 'B':
    Compound: DNA primer strand
  • Chain 'C':
    Compound: DNA template strand with benzo[a]pyrene adduct
  • Heterogens: SUC, SO4, MG, BAP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xc9A (A:)
    akmaftladrvteemladkaalvvevveenyhdapivgiavvnehgrfflrpetaladpq
    fvawlgdetkkksmfdskraavalkwkgielcgvsfdlllaaylldpaqgvddvaaaakm
    kqyeavrpdeavygkgakravpdepvlaehlvrkaaaiwelerpfldelrrneqdrllve
    leqplssilaemefagvkvdtkrleqmgkelaeqlgtveqriyelagqefninspkqlgv
    ilfeklqlpvlkktktgystsadvleklapyheivenilhyrqlgklqstyiegllkvvr
    pdtkkvhtifnqaltqtgrlsstepnlqnipirleegrkirqafvpsesdwlifaadysq
    ielrvlahiaeddnlmeafrrdldihtktamdifqvsedevtpnmrrqakavnfgivygi
    sdyglaqnlnisrkeaaefieryfesfpgvkrymenivqeakqkgyvttllhrrrylpdi
    tsrnfnvrsfaermamntpiqgsaadiikkamidlnarlkeerlqahlllqvhdelilea
    pkeemerlcrlvpevmeqavtlrvplkvdyhygstwydak
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.