PDB entry 1xb2

View 1xb2 on RCSB PDB site
Description: Crystal Structure of Bos taurus mitochondrial Elongation Factor Tu/Ts Complex
Class: translation
Keywords: Protein-protein complex, TRANSLATION
Deposited on 2004-08-27, released 2004-11-23
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-19.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.218
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Elongation factor Tu, mitochondrial
    Species: Bos taurus [TaxId:9913]
    Gene: TUFM
    Database cross-references and differences (RAF-indexed):
    • Uniprot P49410 (Start-408)
      • modified residue (93)
      • modified residue (114)
      • modified residue (147)
      • modified residue (264)
      • modified residue (296)
      • modified residue (331)
      • modified residue (334)
      • modified residue (341)
      • modified residue (355)
      • modified residue (370)
      • modified residue (398)
    Domains in SCOPe 2.03: d1xb2a1, d1xb2a2, d1xb2a3
  • Chain 'B':
    Compound: Elongation factor Ts, mitochondrial
    Species: Bos taurus [TaxId:9913]
    Gene: TSFM
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1xb2b1, d1xb2b2, d1xb2b3
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xb2A (A:)
    aveakktyvrdkphvnvgtighvdhgkttltaaitkilaegggakfkkyeeidnapeera
    rgitinaahveystaarhyahtdcpghadyvknmitgtapldgcilvvaandgpmpqtre
    hlllarqigvehvvvyvnkadavqdsemvelveleirelltefgykgeetpiivgsalca
    leqrdpelglksvqklldavdtyipvptrdlekpfllpvesvysipgrgtvvtgtlergi
    lkkgdeceflghsknirtvvtgiemfhksldraeagdnlgalvrglkredlrrglvmakp
    gsiqphqkveaqvyiltkeeggrhkpfvshfmpvmfsltwdmacriilppgkelampged
    lkltlilrqpmilekgqrftlrdgnrtigtglvtdtpamteedknikws
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xb2A (A:)
    phvnvgtighvdhgkttltaaitkilaehveystaarhyahtdcpghadyvknmitgtap
    ldgcilvvaandgpmpqtrehlllarqigvehvvvyvnkadavqdsemvelveleirell
    tefgykgeetpiivgsalcaleqrdpelglksvqklldavdtyipvptrdlekpfllpve
    svysipgrgtvvtgtlergilkkgdeceflghsknirtvvtgiemfhksldraeagdnlg
    alvrglkredlrrglvmakpgsiqphqkveaqvyiltkeeggrhkpfvshfmpvmfsltw
    dmacriilppgkelampgedlkltlilrqpmilekgqrftlrdgnrtigtglvtdtpamt
    eedknikws
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1xb2B (B:)
    sasskellmklrrktgysfinckkaletcggdlkqaeswlhkqaqkegwskaarlhgrkt
    kegligllqegdttvlvevncetdfvsrnlkfqqlvqqvalgtllhcqnlkdqlstyskg
    flnsselselpagperegslkdqlalaigklgenmilkraawvkvpagfyvgsyvhgamh
    spslhnlvlgkygalvicetselkanladlgrrlgqhvvgmaplsvgslddepggeaetk
    mlsqpylldpsitlgqyvqphgvsvvdfvrfecgegedaadaelehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xb2B (B:)
    sasskellmklrrktgysfinckkaletcggdlkqaeswlhkqaqkegwskaarlhgrkt
    kegligllqegdttvlvevncetdfvsrnlkfqqlvqqvalgtllhcqnlkdqlstyskg
    flnsselselpagperegslkdqlalaigklgenmilkraawvkvpagfyvgsyvhgamh
    spslhnlvlgkygalvicetselkanladlgrrlgqhvvgmaplsvgslddepggeaetk
    mlsqpylldpsitlgqyvqphgvsvvdfvrfecgeg