PDB entry 1xau

View 1xau on RCSB PDB site
Description: structure of the btla ectodomain
Deposited on 2004-08-26, released 2004-10-05
The last revision prior to the SCOP 1.71 freeze date was dated 2004-10-05, with a file datestamp of 2004-10-05.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.206
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1xaua_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xauA (A:)
    mekatkrndeecevqlnikrnskhsawtgelfkiecpvkycvhrpnvtwckhngtiwvpl
    evgpqlytsweenrsvpvfvlhfkpihlsdngsyscstnfnsqvinshsvtihvrersqn
    ss
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xauA (A:)
    cevqlnikrnskhsawtgelfkiecpvkycvhrpnvtwckhngtiwvplevgpqlytswe
    enrsvpvfvlhfkpihlsdngsyscstnfnsqvinshsvtihvr