PDB entry 1xar

View 1xar on RCSB PDB site
Description: Crystal Structure of a fragment of DC-SIGNR (containing the carbohydrate recognition domain and two repeats of the neck).
Deposited on 2004-08-26, released 2004-11-16
The last revision prior to the SCOP 1.71 freeze date was dated 2004-11-16, with a file datestamp of 2004-11-16.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: 0.222
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1xara_
  • Chain 'B':
    Domains in SCOP 1.71: d1xarb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xarA (A:)
    gelpeksklqeiyqeltqlkaavgelpdqskqqqiyqeltdlktaferlcrhcpkdwtff
    qgncyfmsnsqrnwhdsvtacqevraqlvviktaeeqnflqlqtsrsnrfswmglsdlnq
    egtwqwvdgsplspsfqrywnsgepnnsgnedcaefsgsgwndnrcdvdnywickkpaac
    frde
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xarA (A:)
    yqeltdlktaferlcrhcpkdwtffqgncyfmsnsqrnwhdsvtacqevraqlvviktae
    eqnflqlqtsrsnrfswmglsdlnqegtwqwvdgsplspsfqrywnsgepnnsgnedcae
    fsgsgwndnrcdvdnywickkpaacf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1xarB (B:)
    gelpeksklqeiyqeltqlkaavgelpdqskqqqiyqeltdlktaferlcrhcpkdwtff
    qgncyfmsnsqrnwhdsvtacqevraqlvviktaeeqnflqlqtsrsnrfswmglsdlnq
    egtwqwvdgsplspsfqrywnsgepnnsgnedcaefsgsgwndnrcdvdnywickkpaac
    frde
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xarB (B:)
    eltdlktaferlcrhcpkdwtffqgncyfmsnsqrnwhdsvtacqevraqlvviktaeeq
    nflqlqtsrsnrfswmglsdlnqegtwqwvdgsplspsfqrywnsgepnnsgnedcaefs
    gsgwndnrcdvdnywickkpaacf