PDB entry 1x9m

View 1x9m on RCSB PDB site
Description: T7 DNA polymerase in complex with an N-2-acetylaminofluorene-adducted DNA
Class: transferase/electron transport/DNA
Keywords: DNA ploymerase, N-2-acetylaminofluorene, Replication block, Mutagenesis, TRANSFERASE/ELECTRON TRANSPORT/DNA COMPLEX
Deposited on 2004-08-23, released 2004-10-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.213
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA polymerase
    Species: Enterobacteria phage T7 [TaxId:10760]
    Gene: 5
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1x9ma1, d1x9ma2
  • Chain 'B':
    Compound: Thioredoxin 1
    Species: Escherichia coli [TaxId:562]
    Gene: trxA, tsnC, fipA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1x9mb_
  • Chain 'C':
    Compound: 5'-d(*gp*gp*ap*gp*ap*gp*tp*gp*ap*tp*tp*gp*gp*tp*ap*gp*tp*gp*tp*gp*ap*(2dt))-3'
  • Chain 'D':
    Compound: 5'-d(*cp*cp*cp*(8fg)p*ap*tp*cp*ap*cp*ap*cp*tp*ap*cp*cp*ap*ap*tp*cp*ap*cp*tp*cp*tp*cp*c)-3'
  • Heterogens: MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1x9mA (A:)
    mivsdieanallesvtkfhcgviydystaeyvsyrpsdfgayldaleaevargglivfhn
    ghkydvpaltklaklqlnrefhlprencidtlvlsrlihsnlkdtdmgllrsgklpgale
    awgyrlgemkgeykddfkrmleeqgeeyvdgmewwnfneemmdynvqdvvvtkallekll
    sdkhyfppeidftdvgyttfwsesleavdiehraawllakqerngfpfdtkaieelyvel
    aarrsellrkltetfgswyqpkggtemfchprtgkplpkypriktpkvggifkkpknkaq
    regrepceldtreyvagapytpvehvvfnpssrdhiqkklqeagwvptkytdkgapvvdd
    evlegvrvddpekqaaidlikeylmiqkrigqsaegdkawlryvaedgkihgsvnpngav
    tgrathafpnlaqipgvrspygeqcraafgaehhldgitgkpwvqagidasglelrclah
    fmarfdngeyaheilngdihtknqiaaelptrdnaktfiygflygagdekigqivgagke
    rgkelkkkflentpaiaalresiqqtlvessqwvageqqvkwkrrwikgldgrkvhvrsp
    haalntllqsagalicklwiikteemlvekglkhgwdgdfaymawvhdeiqvgcrteeia
    qvvietaqeamrwvgdhwnfrclldtegkmgpnwaich
    

    Sequence, based on observed residues (ATOM records): (download)
    >1x9mA (A:)
    mivsdieanallesvtkfhcgviydystaeyvsyrpsdfgayldaleaevargglivfhn
    ghkydvpaltklaklqlnrefhlprencidtlvlsrlihsnlkdtdmgllrsgklpgale
    awgyrlgemkgeykddfkrmleeqgeeyvdgmewwnfneemmdynvqdvvvtkallekll
    sdkhyfppeidftdvgyttfwsesleavdiehraawllakqerngfpfdtkaieelyvel
    aarrsellrkltetfgswyqpkggtemfchprtgkplpkypriktpkvggifkceldtre
    yvagapytpvehvvfnpssrdhiqkklqeagwvptkytdkgapvvddevlegvrvddpek
    qaaidlikeylmiqkrigqsaegdkawlryvaedgkihgsvnpngavtgrathafpnlaq
    ipgvrspygeqcraafgaehhldgitgkpwvqagidasglelrclahfmarfdngeyahe
    ilngdihtknqiaaelptrdnaktfiygflygagdekigqivgagkergkelkkkflent
    paiaalresiqqtlvevkwkrrwikgldgrkvhvrsphaalntllqsagalicklwiikt
    eemlvekglkhgwdgdfaymawvhdeiqvgcrteeiaqvvietaqeamrwvgdhwnfrcl
    ldtegkmgpnwaich
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1x9mB (B:)
    sdkiihltddsfdtdvlkadgailvdfwaewcgpckmiapildeiadeyqgkltvaklni
    dqnpgtapkygirgiptlllfkngevaatkvgalskgqlkefldanla
    

    Sequence, based on observed residues (ATOM records): (download)
    >1x9mB (B:)
    kiihltddsfdtdvlkadgailvdfwaewcgpckmiapildeiadeyqgkltvaklnidq
    npgtapkygirgiptlllfkngevaatkvgalskgqlkefldanl
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.