PDB entry 1x8m

View 1x8m on RCSB PDB site
Description: X-ray structure of pectin degrading enzyme 5-keto 4-deoxyuronate isomerase from Escherichia coli
Class: isomerase
Keywords: Structural genomics, protein structure initiative, 5-keto 4-deoxyuronate isomerase, NYSGXRC target T1827, PSI, New York Structural GenomiX Research Consortium
Deposited on 2004-08-18, released 2004-09-21
The last revision prior to the SCOP 1.75 freeze date was dated 2005-01-25, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.257
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 4-deoxy-L-threo-5-hexosulose-uronate ketol-isomerase
    Species: Escherichia coli
    Gene: kduI
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q46938
      • cloning artifact (1-2)
    Domains in SCOP 1.75: d1x8ma_
  • Chain 'B':
    Compound: 4-deoxy-L-threo-5-hexosulose-uronate ketol-isomerase
    Species: Escherichia coli
    Gene: kduI
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q46938
      • cloning artifact (1-2)
    Domains in SCOP 1.75: d1x8mb_
  • Chain 'C':
    Compound: 4-deoxy-L-threo-5-hexosulose-uronate ketol-isomerase
    Species: Escherichia coli
    Gene: kduI
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q46938
      • cloning artifact (1-2)
    Domains in SCOP 1.75: d1x8mc_
  • Chain 'D':
    Compound: 4-deoxy-L-threo-5-hexosulose-uronate ketol-isomerase
    Species: Escherichia coli
    Gene: kduI
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q46938
      • cloning artifact (1-2)
    Domains in SCOP 1.75: d1x8md_
  • Chain 'E':
    Compound: 4-deoxy-L-threo-5-hexosulose-uronate ketol-isomerase
    Species: Escherichia coli
    Gene: kduI
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q46938
      • cloning artifact (1-2)
    Domains in SCOP 1.75: d1x8me_
  • Chain 'F':
    Compound: 4-deoxy-L-threo-5-hexosulose-uronate ketol-isomerase
    Species: Escherichia coli
    Gene: kduI
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q46938 (3-End)
      • cloning artifact (1-2)
    Domains in SCOP 1.75: d1x8mf_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1x8mA (A:)
    msldvrqsihsahaktldtqglrneflvekvfvadeytmvyshidriivggimpitktvs
    vggevgkqlgvsyflerrelgviniggagtitvdgqcyeighrdalyvgkgakevvfasi
    dtgtpakfyyncapahttyptkkvtpdevspvtlgdnltsnrrtinkyfvpdvletcqls
    mgltelapgnlwntmpchtherrmevyfyfnmdddacvfhmmgqpqetrhivmhneqavi
    spswsihsgvgtkaytfiwgmvgenqvfddmdhvavkdlreghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1x8mA (A:)
    sldvrqsihsahaktldtqglrneflvekvfvadeytmvyshidriivggimpitktvsv
    ggevgkqlgvsyflerrelgviniggagtitvdgqcyeighrdalyvgkgakevvfasid
    tgtpakfyyncapahttyptkkvtpdevspvtlgdnltsnrrtinkyfvpdvletcqlsm
    gltelapgnlwntrmevyfyfnmdddacvfhmmgqpqetrhivmhneqavispswsihsg
    vgtkaytfiwgmvgenqvf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1x8mB (B:)
    msldvrqsihsahaktldtqglrneflvekvfvadeytmvyshidriivggimpitktvs
    vggevgkqlgvsyflerrelgviniggagtitvdgqcyeighrdalyvgkgakevvfasi
    dtgtpakfyyncapahttyptkkvtpdevspvtlgdnltsnrrtinkyfvpdvletcqls
    mgltelapgnlwntmpchtherrmevyfyfnmdddacvfhmmgqpqetrhivmhneqavi
    spswsihsgvgtkaytfiwgmvgenqvfddmdhvavkdlreghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1x8mB (B:)
    sldvrqsihsahaktldtqglrneflvekvfvadeytmvyshidriivggimpitktvsv
    ggevgkqlgvsyflerrelgviniggagtitvdgqcyeighrdalyvgkgakevvfasid
    tgtpakfyyncapahttyptkkvtpdevspvtlgdnltsnrrtinkyfvpdvletcqlsm
    gltelapgnlwntrmevyfyfnmdddacvfhmmgqpqetrhivmhneqavispswsihsg
    vgtkaytfiwgmvgenqvf
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1x8mC (C:)
    msldvrqsihsahaktldtqglrneflvekvfvadeytmvyshidriivggimpitktvs
    vggevgkqlgvsyflerrelgviniggagtitvdgqcyeighrdalyvgkgakevvfasi
    dtgtpakfyyncapahttyptkkvtpdevspvtlgdnltsnrrtinkyfvpdvletcqls
    mgltelapgnlwntmpchtherrmevyfyfnmdddacvfhmmgqpqetrhivmhneqavi
    spswsihsgvgtkaytfiwgmvgenqvfddmdhvavkdlreghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1x8mC (C:)
    sldvrqsihsahaktldtqglrneflvekvfvadeytmvyshidriivggimpitktvsv
    ggevgkqlgvsyflerrelgviniggagtitvdgqcyeighrdalyvgkgakevvfasid
    tgtpakfyyncapahttyptkkvtpdevspvtlgdnltsnrrtinkyfvpdvletcqlsm
    gltelapgnlwntrmevyfyfnmdddacvfhmmgqpqetrhivmhneqavispswsihsg
    vgtkaytfiwgmvgenqvf
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1x8mD (D:)
    msldvrqsihsahaktldtqglrneflvekvfvadeytmvyshidriivggimpitktvs
    vggevgkqlgvsyflerrelgviniggagtitvdgqcyeighrdalyvgkgakevvfasi
    dtgtpakfyyncapahttyptkkvtpdevspvtlgdnltsnrrtinkyfvpdvletcqls
    mgltelapgnlwntmpchtherrmevyfyfnmdddacvfhmmgqpqetrhivmhneqavi
    spswsihsgvgtkaytfiwgmvgenqvfddmdhvavkdlreghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1x8mD (D:)
    sldvrqsihsahaktldtqglrneflvekvfvadeytmvyshidriivggimpitktvsv
    ggevgkqlgvsyflerrelgviniggagtitvdgqcyeighrdalyvgkgakevvfasid
    tgtpakfyyncapahttyptkkvtpdevspvtlgdnltsnrrtinkyfvpdvletcqlsm
    gltelapgnlwntrmevyfyfnmdddacvfhmmgqpqetrhivmhneqavispswsihsg
    vgtkaytfiwgmvgenqvf
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1x8mE (E:)
    msldvrqsihsahaktldtqglrneflvekvfvadeytmvyshidriivggimpitktvs
    vggevgkqlgvsyflerrelgviniggagtitvdgqcyeighrdalyvgkgakevvfasi
    dtgtpakfyyncapahttyptkkvtpdevspvtlgdnltsnrrtinkyfvpdvletcqls
    mgltelapgnlwntmpchtherrmevyfyfnmdddacvfhmmgqpqetrhivmhneqavi
    spswsihsgvgtkaytfiwgmvgenqvfddmdhvavkdlreghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1x8mE (E:)
    sldvrqsihsahaktldtqglrneflvekvfvadeytmvyshidriivggimpitktvsv
    ggevgkqlgvsyflerrelgviniggagtitvdgqcyeighrdalyvgkgakevvfasid
    tgtpakfyyncapahttyptkkvtpdevspvtlgdnltsnrrtinkyfvpdvletcqlsm
    gltelapgnlwntrmevyfyfnmdddacvfhmmgqpqetrhivmhneqavispswsihsg
    vgtkaytfiwgmvgenqvf
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1x8mF (F:)
    msldvrqsihsahaktldtqglrneflvekvfvadeytmvyshidriivggimpitktvs
    vggevgkqlgvsyflerrelgviniggagtitvdgqcyeighrdalyvgkgakevvfasi
    dtgtpakfyyncapahttyptkkvtpdevspvtlgdnltsnrrtinkyfvpdvletcqls
    mgltelapgnlwntmpchtherrmevyfyfnmdddacvfhmmgqpqetrhivmhneqavi
    spswsihsgvgtkaytfiwgmvgenqvfddmdhvavkdlreghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1x8mF (F:)
    sldvrqsihsahaktldtqglrneflvekvfvadeytmvyshidriivggimpitktvsv
    ggevgkqlgvsyflerrelgviniggagtitvdgqcyeighrdalyvgkgakevvfasid
    tgtpakfyyncapahttyptkkvtpdevspvtlgdnltsnrrtinkyfvpdvletcqlsm
    gltelapgnlwntrmevyfyfnmdddacvfhmmgqpqetrhivmhneqavispswsihsg
    vgtkaytfiwgmvgenqvf