PDB entry 1x72

View 1x72 on RCSB PDB site
Description: Crystal structure of a putative peptidyl-arginine deiminase.
Class: structural genomics, unknown function
Keywords: Structural Genomics, Protein Structure Initiative, NYSGRC, T1664, peptidyl-arginine deiminase, jhp0042, PSI, New York Structural Genomics Research Consortium, PSI, Protein Structure Initiative
Deposited on 2004-08-12, released 2004-09-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2006-05-30, with a file datestamp of 2007-06-01.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.198
AEROSPACI score: -1.68 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: putative peptidyl-arginine deiminase
    Species: Helicobacter pylori J99
    Gene: jhp0042
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9ZN18 (3-331)
      • cloning artifact (0-2)
      • modified residue (5)
      • modified residue (17)
      • engineered (24)
      • engineered (64)
      • engineered (91)
      • modified residue (136)
      • modified residue (177)
      • modified residue (235)
      • engineered (261)
      • modified residue (328)
      • cloning artifact (332-333)
    Domains in SCOPe 2.07: d1x72a1, d1x72a2, d1x72a3
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1x72A (A:)
    mslkrmlaefekiqailmafphefsdwaycieearesflhiiqtiakhakvlvcvhtndt
    igyemlknlpgveiaridtndtwardfgaisienhgvlecldfgfngwglkypsnldnqv
    nfklkhlgflkhplktmpyileggsiesdgagsiltntqclleknrnphlnqngietmlk
    kelgakqvlwysygylkgddtdshtdtlarflnkdtivysacedendehytalkkmqeel
    ktfkkldgtpyklipleipkaiynenqqrlpatyvnfllcnnalivptyndpndtlilet
    lrqhtplevigvdcntlikqhgslhcvtmqlyeg