PDB entry 1x6z

View 1x6z on RCSB PDB site
Description: Structure 1: cryocooled crystal structure of the truncated pak pilin from Pseudomonas aeruginosa at 0.78A resolution
Class: structural protein
Keywords: type IV pilin, lectin, adhesin
Deposited on 2004-08-12, released 2005-04-19
The last revision prior to the SCOP 1.73 freeze date was dated 2005-04-19, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 0.78 Å
R-factor: 0.143
AEROSPACI score: 1.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: fimbrial protein
    Species: Pseudomonas aeruginosa
    Gene: PILA, FIMA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02973 (7-122)
      • cloning artifact (3-6)
    Domains in SCOP 1.73: d1x6za1
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1x6zA (A:)
alegtefarsegasalasvnplkttveealsrgwsvksgtgtedatkkevplgvaadank
lgtialkpdpadgtaditltftmggagpknkgkiitltrtaadglwkctsdqdeqfipkg
csr

    Sequence, based on observed residues (ATOM records): (download) 
    >1x6zA (A:)
gtefarsegasalasvnplkttveealsrgwsvksgtgtedatkkevplgvaadanklgt
ialkpdpadgtaditltftmggagpknkgkiitltrtaadglwkctsdqdeqfipkgcsr