PDB entry 1x5z

View 1x5z on RCSB PDB site
Description: Solution structure of the fibronectin type-III domain of human protein tyrosine phosphatase, receptor type, D isoform 4 variant
Class: hydrolase
Keywords: Fibronectin type III domain containing protein, structural genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, HYDROLASE
Deposited on 2005-05-17, released 2005-11-17
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Receptor-type tyrosine-protein phosphatase delta
  Species: Homo sapiens [TaxId:9606]
  Gene: PTPRD
  Database cross-references and differences (RAF-indexed):
  • Uniprot P23468 (7-108)
    • cloning artifact (0-6)
    • cloning artifact (109-114)
  Domains in SCOPe 2.06: d1x5za1, d1x5za2, d1x5za3

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1x5zA (A:)
  gssgssgdiqvitqtgvpgqplnfkaepesetsillswtpprsdtianyelvykdgehge
  eqritiepgtsyrlqglkpnslyyfrlaarspqglgastaeisartmqssgpssg