PDB entry 1x5u

View 1x5u on RCSB PDB site
Description: Solution structure of RRM domain in splicing factor 3B
Class: RNA binding protein
Keywords: NMR,structure genomics,RRM domain,splicing factor 3B, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, RNA BINDING PROTEIN
Deposited on 2005-05-16, released 2005-11-16
Made obsolete by 5gvq on 2017-04-12

The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Splicing factor 3B subunit 4 (Spliceosome associated protein 49) (SAP 49) (SF3b50) (Pre-mRNA splicing factor SF3b 49 kDa subunit).
    Species: Homo sapiens [TaxId:9606]
    Gene: SF3B4, SAP49
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q15427 (7-98)
      • cloning artifact (0-6)
      • engineered (77)
      • cloning artifact (99-104)
    Domains in SCOPe 2.06: d1x5ua1, d1x5ua2, d1x5ua3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1x5uA (A:)
    gssgssgpisernqdatvyvggldekvsepllwelflqagpvvnthmpkdrvtgqhqgyg
    fveflseedadyaikimdmiklygkpirvnkasahnknlsgpssg