PDB entry 1x5t

View 1x5t on RCSB PDB site
Description: Solution structure of the second RRM domain in splicing factor = 3B
Class: RNA binding protein
Keywords: NMR, structure genomics, RRM domain, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, RNA BINDING PROTEIN
Deposited on 2005-05-16, released 2005-11-16
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Splicing factor 3B subunit 4
    Species: Homo sapiens [TaxId:9606]
    Gene: SF3B4, SAP49
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q15427 (7-89)
      • cloning artifact (0-6)
      • cloning artifact (90-95)
    Domains in SCOPe 2.06: d1x5ta1, d1x5ta2, d1x5ta3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1x5tA (A:)
    gssgssgifignldpeidekllydtfsafgvilqtpkimrdpdtgnskgyafinfasfda
    sdaaieamngqylcnrpitvsyafkkdskgsgpssg