PDB entry 1x5o

View 1x5o on RCSB PDB site
Description: Solution structure of RRM domain in RNA binding motif, single-stranded interacting protein 1
Class: RNA binding protein
Keywords: NMR, structure genomics, RRM domain, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, RNA BINDING PROTEIN
Deposited on 2005-05-16, released 2005-11-16
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: RNA binding motif, single-stranded interacting protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene: RBMS1, MSSP, MSSP1, SCR2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P29558 (7-107)
      • cloning artifact (0-6)
      • cloning artifact (108-113)
    Domains in SCOPe 2.05: d1x5oa1

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1x5oA (A:)
    gssgssglkasgvqaqmakqqeqdptnlyisnlplsmdeqelenmlkpfgqvistrilrd
    ssgtsrgvgfarmestekceavighfngkfiktppgvsaptepllckfsgpssg