PDB entry 1x5d

View 1x5d on RCSB PDB site
Description: The solution structure of the second thioredoxin-like domain of human Protein disulfide-isomerase A6
Class: isomerase
Keywords: PDIA6, ERP5, P5, TXNDC7, Thioredoxin like domain, redox, structural genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, ISOMERASE
Deposited on 2005-05-15, released 2005-11-15
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Protein disulfide-isomerase A6
  Species: Homo sapiens [TaxId:9606]
  Gene: Pdia6
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q15084 (7-126)
    • cloning artifact (0-6)
    • cloning artifact (127-132)
  Domains in SCOPe 2.08: d1x5da1, d1x5da2, d1x5da3

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1x5dA (A:)
  gssgssgdvieltddsfdknvldsedvwmvefyapwcghcknlepewaaaasevkeqtkg
  kvklaavdatvnqvlasrygirgfptikifqkgespvdydggrtrsdivsraldlfsdna
  pppellesgpssg