PDB entry 1x50

View 1x50 on RCSB PDB site
Description: Solution structure of the C-terminal gal-bind lectin domain from human galectin-4
Class: sugar binding protein
Keywords: Gal-bind lectin, galectin, sugar binding, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, SUGAR BINDING PROTEIN
Deposited on 2005-05-15, released 2005-11-15
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Galectin-4
    Species: Homo sapiens [TaxId:9606]
    Gene: LGALS4
    Database cross-references and differences (RAF-indexed):
    • Uniprot P56470 (7-157)
      • cloning artifact (0-6)
      • cloning artifact (158-163)
    Domains in SCOPe 2.06: d1x50a1, d1x50a2, d1x50a3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1x50A (A:)
    gssgssghqqlnslptmegpptfnppvpyfgrlqggltarrtiiikgyvpptgksfainf
    kvgssgdialhinprmgngtvvrnsllngswgseekkithnpfgpgqffdlsircgldrf
    kvyangqhlfdfahrlsafqrvdtleiqgdvtlsyvqisgpssg