PDB entry 1x4z

View 1x4z on RCSB PDB site
Description: Solution structure of the 2nd fibronectin type III domain from mouse biregional cell adhesion molecule-related/down-regulated oncogenes (Cdon) binding protein
Class: cell adhesion
Keywords: fibronectin type III, fn3, immunoglobulin-like beta-sandwich fold, cell adhesion, structural genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on 2005-05-15, released 2005-11-15
The last revision prior to the SCOP 1.73 freeze date was dated 2005-11-15, with a file datestamp of 2007-06-04.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: biregional cell adhesion molecule-related/down-regulated oncogenes (Cdon)binding protein
    Species: MUS MUSCULUS
    Gene: Boc
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6KAM5 (7-114)
      • cloning artifact (0-6)
      • cloning artifact (115-120)
    Domains in SCOP 1.73: d1x4za1

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1x4zA (A:)
    gssgssgsqpdhgrlsppeapdrptistasetsvyvtwiprgnggfpiqsfrveykklkk
    vgdwilatsaippsrlsveitglekgisykfrvralnmlgesepsapsrpyvvsgsgpss
    g