PDB entry 1x4a

View 1x4a on RCSB PDB site
Description: Solution structure of RRM domain in splicing factor SF2
Class: RNA binding protein
Keywords: NMR, structure genomics, SURP domain, splicing factor SF2, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on 2005-05-14, released 2005-11-14
The last revision prior to the SCOP 1.73 freeze date was dated 2005-11-14, with a file datestamp of 2007-06-04.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: splicing factor, arginine/serine-rich 1 (splicing factor 2, alternate splicing factor) variant
  Species: HOMO SAPIENS
  Gene: SFRS1; ASF; SF2; SF2P33
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q07955 (7-102)
    • cloning artifact (0-6)
    • cloning artifact (103-108)
  Domains in SCOP 1.73: d1x4aa1

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1x4aA (A:)
  gssgssgmsgggvirgpagnndcriyvgnlppdirtkdiedvfykygairdidlknrrgg
  ppfafvefedprdaedavygrdgydydgyrlrvefprsgrgtgsgpssg