PDB entry 1x41

View 1x41 on RCSB PDB site
Description: Solution structure of the Myb-like DNA binding domain of human Transcriptional adaptor 2-like, isoform B
Class: transcription
Keywords: Transcriptional adaptor protein2, transcriptional activation, Myb domain, Structural genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on 2005-05-12, released 2005-11-12
The last revision prior to the SCOP 1.73 freeze date was dated 2005-11-12, with a file datestamp of 2007-06-04.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transcriptional adaptor 2-like, isoform b
    Species: HOMO SAPIENS
    Gene: Tada2l
    Database cross-references and differences (RAF-indexed):
    • Uniprot O75478 (7-53)
      • cloning artifact (0-6)
      • cloning artifact (54-59)
    Domains in SCOP 1.73: d1x41a1

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1x41A (A:)
    gssgssgdpswtaqeemalleavmdcgfgnwqdvanqmctktkeecekhymkyfsgpssg