PDB entry 1x3s

View 1x3s on RCSB PDB site
Description: Crystal structure of human Rab18 in complex with Gppnhp
Class: endocytosis/exocytosis
Keywords: GTPase, Rab, GNP, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, ENDOCYTOSIS/EXOCYTOSIS COMPLEX
Deposited on 2005-05-10, released 2005-11-10
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.32 Å
R-factor: 0.185
AEROSPACI score: 0.72 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ras-related protein Rab-18
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9NP72
      • modified residue (124)
      • modified residue (151)
    Domains in SCOPe 2.03: d1x3sa1
  • Heterogens: MG, GNP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1x3sA (A:)
    gssgssgmdedvlttlkiliigesgvgksslllrftddtfdpelaatigvdfkvktisvd
    gnkaklaiwdtagqerfrtltpsyyrgaqgvilvydvtrrdtfvkldnwlneletyctrn
    divnmlvgnkidkenrevdrneglkfarkhsmlfieasaktcdgvqcafeelvekiiqtp
    glwesenqnsgpssg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1x3sA (A:)
    dedvlttlkiliigesgvgksslllrftddtfdpelaatigvdfkvktisvdgnkaklai
    wdtagqerfrtltpsyyrgaqgvilvydvtrrdtfvkldnwlneletyctrndivnmlvg
    nkidkenrevdrneglkfarkhsmlfieasaktcdgvqcafeelvekiiqtpglwes