PDB entry 1x37

View 1x37 on RCSB PDB site
Description: Structure of Bacillus subtilis Lon protease SSD domain
Class: hydrolase
Keywords: AAA+ superfamily, protease, SSD domain, solution structure, hydrolase
Deposited on 2005-04-30, released 2005-10-30
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ATP-dependent protease La 1
    Species: Bacillus subtilis [TaxId:1423]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1x37a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1x37A (A:)
    magyteiekleivkdhllpkqikehglkksnlqlrdqaildiiryytreagvrslerqla
    aicrkaakaivaeerkritvteknlqdfigkrifrygqaetedqvgvvtglayttvlrhh
    hhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1x37A (A:)
    agyteiekleivkdhllpkqikehglkksnlqlrdqaildiiryytreagvrslerqlaa
    icrkaakaivaeerkritvteknlqdfigkrifry