PDB entry 1x1r

View 1x1r on RCSB PDB site
Description: Crystal structure of M-Ras in complex with GDP
Class: signaling protein
Keywords: GTP-binding, SIGNALING PROTEIN
Deposited on 2005-04-12, released 2005-07-26
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.3 Å
R-factor: 0.183
AEROSPACI score: 0.74 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ras-related protein M-Ras
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1x1ra1
  • Heterogens: MG, GDP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1x1rA (A:)
    matsavpsenlptyklvvvgdggvgksaltiqffqkifvpdydptiedsylkhteidnqw
    aildvldtagqeefsamreqymrtgdgflivysvtdkasfehvdrfhqlilrvkdresfp
    milvankvdlmhlrkvtrdqgkematkynipyietsakdpplnvdktfhdlvrvirqq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1x1rA (A:)
    nlptyklvvvgdggvgksaltiqffqkifvpdydptiedsylkhteidnqwaildvldta
    gqeefsamreqymrtgdgflivysvtdkasfehvdrfhqlilrvkdresfpmilvankvd
    lmhlrkvtrdqgkematkynipyietsakdpplnvdktfhdlvrvirqq