PDB entry 1x1q

View 1x1q on RCSB PDB site
Description: Crystal structure of tryptophan synthase beta chain from Thermus thermophilus HB8
Class: lyase
Keywords: structural genomics, Thermus thermophilus, RIKEN Structural Genomics/Proteomics Initiative, RSGI, NPPSFA, National Project on Protein Structural and Functional Analyses, LYASE
Deposited on 2005-04-11, released 2006-08-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.201
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: tryptophan synthase beta chain
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P16609
      • modified residue (122)
      • modified residue (155)
      • modified residue (170)
      • modified residue (220-221)
      • modified residue (307)
      • modified residue (388)
      • modified residue (410)
    Domains in SCOPe 2.07: d1x1qa_
  • Chain 'B':
    Compound: tryptophan synthase beta chain
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P16609
      • modified residue (122)
      • modified residue (155)
      • modified residue (170)
      • modified residue (220-221)
      • modified residue (388)
      • modified residue (410)
    Domains in SCOPe 2.07: d1x1qb_
  • Heterogens: CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1x1qA (A:)
    mgvvlargafrersmltlpdfplpdargrfgpyggryvpetlipaleeleaayreakkdp
    afleeldhylrqfagrptplyhakrlseywggaqvflkredllhtgahkinntlgqalla
    rrmgkrrviaetgagqhgvsvatvaalfglecvvymgeedvrrqalnvfrmkllgaevrp
    vaagsrtlkdatneairdwitnvrttfyilgsvvgphpypmmvrdfqsvigeevkrqsle
    lfgrlpdaliaavgggsnaiglfapfaylpegrpkligveaageglstgrhaasigagkr
    gvlhgsymyllydhdgqitpahsvsagldypgvgpehsyyadagvaeyasvtdeealegf
    kllarlegiipalesahaiayaakvvpemdkdqvvvinlsgrgdkdvtevmrllggel
    

    Sequence, based on observed residues (ATOM records): (download)
    >1x1qA (A:)
    ltlpdfplpdargrfgpyggryvpetlipaleeleaayreakkdpafleeldhylrqfag
    rptplyhakrlseywggaqvflkredllhtgahkinntlgqallarrmgkrrviaetgag
    qhgvsvatvaalfglecvvymgeedvrrqalnvfrmkllgaevrpvaagsrtlkdatnea
    irdwitnvrttfyilgsvvgphpypmmvrdfqsvigeevkrqslelfgrlpdaliaavgg
    gsnaiglfapfaylpegrpkligveaageglstgrhaasigagkrgvlhgsymyllydyp
    gvgpehsyyadagvaeyasvtdeealegfkllarlegiipalesahaiayaakvvpemdk
    dqvvvinlsgrgdkdvtevmrllgg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1x1qB (B:)
    mgvvlargafrersmltlpdfplpdargrfgpyggryvpetlipaleeleaayreakkdp
    afleeldhylrqfagrptplyhakrlseywggaqvflkredllhtgahkinntlgqalla
    rrmgkrrviaetgagqhgvsvatvaalfglecvvymgeedvrrqalnvfrmkllgaevrp
    vaagsrtlkdatneairdwitnvrttfyilgsvvgphpypmmvrdfqsvigeevkrqsle
    lfgrlpdaliaavgggsnaiglfapfaylpegrpkligveaageglstgrhaasigagkr
    gvlhgsymyllydhdgqitpahsvsagldypgvgpehsyyadagvaeyasvtdeealegf
    kllarlegiipalesahaiayaakvvpemdkdqvvvinlsgrgdkdvtevmrllggel
    

    Sequence, based on observed residues (ATOM records): (download)
    >1x1qB (B:)
    ltlpdfplpdargrfgpyggryvpetlipaleeleaayreakkdpafleeldhylrqfag
    rptplyhakrlseywggaqvflkredllhtgahkinntlgqallarrmgkrrviaetgag
    qhgvsvatvaalfglecvvymgeedvrrqalnvfrmkllgaevrptlkdatneairdwit
    nvrttfyilgsvvgphpypmmvrdfqsvigeevkrqslelfgrlpdaliaavgggsnaig
    lfapfaylpegrpkligveaasvsagldypgvgpehsyyadagvaeyasvtdeealegfk
    llarlegiipalesahaiayaakvvpemdkdqvvvinlsgrgdkdvtevmrllg