PDB entry 1x1j

View 1x1j on RCSB PDB site
Description: Crystal Structure of Xanthan Lyase (N194A) with a Substrate.
Class: lyase
Keywords: alpha/alpha barrel, beta sandwich, LYASE
Deposited on 2005-04-04, released 2005-07-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.179
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: xanthan lyase
    Species: Bacillus sp. GL1 [TaxId:84635]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • GB BAB21059 (0-751)
      • engineered (168)
    Domains in SCOPe 2.07: d1x1ja1, d1x1ja2, d1x1ja3
  • Heterogens: 46D, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1x1jA (A:)
    sdefdalrikwatlltggpaldpadsdiaartdklaqdandywedmdlsssrtyiwyalr
    gngtsdnvnavyerlrtmalaattvgsslygnadlkedildaldwlyvnsynstrsrsay
    nwwhwqlgipmslndiavllyddisaarmatymdtidyftpsigltgaarawqaivvgvr
    avivkdavklaaarnglsgtgifpyatggdgfyadgsfvqhttfaytggygssvlettan
    lmyllsgstwsvsdpnqsnvwqwiyeayrpllykgammdmvrgreisrsyaqdhavghgi
    vasivrlaqfapaphaaafkqiakrviqedtfssfygdvstdtirlakaivddpsiapaa
    apnlykqyaamdravlqrpgfalglalystrissyesinsengrgwytgagatylynqdl
    aqysedywptvdayripgttvasgtpiasgtgtsswtggvslagqygasgmdlsygaynl
    sarkswfmfddeivalgsgisstagipietvvdnrklngagdnawtangaalstglgvaq
    tltgvnwvhlagntadgsdigyyfpggatlqtkreartgtwkqinnrpatpstavtrnye
    tmwidhgtnpsgasygyvllpnktsaqvgayaadpaieivvntsgvqsvkektlglvgan
    fwtdttqtadlitsnkkasvmtreiaderleasvsdptqanngtiaielarsaegysadp
    gitvtqlaptikftvnvngakgksfhasfqlg