PDB entry 1x1e

View 1x1e on RCSB PDB site
Description: Crystal Structure of TT0495 protein from Thermus thermophilus HB8
Class: oxidoreductase
Keywords: dehydrogenase, Structural Genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI, NPPSFA, National Project on Protein Structural and Functional Analyses, OXIDOREDUCTASE
Deposited on 2005-04-04, released 2006-07-11
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.76 Å
R-factor: 0.203
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 2-deoxy-D-gluconate 3-dehydrogenase
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1x1ea_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1x1eA (A:)
merkalvtggsrgigraiaealvargyrvaiasrnpeeaaqslgavplptdlekddpkgl
vkralealgglhvlvhaaavnvrkpalelsyeewrrvlylhldvafllaqaaaphmaeag
wgrvlfigsvttftaggpvpipayttaktallgltralakewarlgirvnllcpgyvete
ftlplrqnpelyepitaripmgrwarpeeiarvaavlcgdeaeyltgqavavdggflay