PDB entry 1x18

View 1x18 on RCSB PDB site
Description: Contact sites of ERA GTPase on the THERMUS THERMOPHILUS 30S SUBUNIT
Class: structural protein/RNA
Keywords: Contact sites of Era protein on the 30S ribosomal subunit, STRUCTURAL PROTEIN-RNA COMPLEX
Deposited on 2005-04-02, released 2005-05-17
The last revision prior to the SCOPe 2.03 freeze date was dated 2010-11-17, with a file datestamp of 2010-11-12.
Experiment type: EM
Resolution: 13.5 Å
R-factor: N/A
AEROSPACI score: -0.13 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 5'-r(p*cp*gp*ap*up*gp*gp*cp*gp*ap*ap*g)-3'
    Species: Thermus thermophilus [TaxId:274]
  • Chain 'B':
    Compound: RNA (31-mer)
    Species: Thermus thermophilus [TaxId:274]
  • Chain 'C':
    Compound: 5'-r(p*up*up*cp*cp*cp*gp*gp*gp*cp*cp*up*gp*gp*gp*gp*cp*cp*cp*gp*c)-3'
    Species: Thermus thermophilus [TaxId:274]
  • Chain 'D':
    Compound: 5'-r(p*up*gp*up*up*gp*gp*gp*up*up*ap*ap*gp*up*cp*cp*cp*gp*cp*ap*ap*cp*gp*ap*g)-3'
    Species: Thermus thermophilus [TaxId:274]
  • Chain 'E':
    Compound: 30S ribosomal protein S2
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1x18e1
  • Chain 'F':
    Compound: 30S ribosomal protein S7
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1x18f1
  • Chain 'G':
    Compound: 30S ribosomal protein S11
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1x18g1
  • Chain 'H':
    Compound: 30S ribosomal protein S18
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1x18h1
  • Chain 'X':
    Compound: GTP-binding protein era
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed):
    • PDB 1X18 (0-291)
    Domains in SCOPe 2.03: d1x18x1, d1x18x2

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1x18E (E:)
    vkelleagvhfgherkrwnpkfaryiyaerngihiidlqktmeelertfrfiedlamrgg
    tilfvgtkkqaqdivrmeaeragmpyvnqrwlggmltnfktiqrvhrleelealfaspei
    eerpkkeqrlhelerlqkylsgfrllkrlpdaifvvdptkeaiavrearklfipvialad
    tdsdpdlvdyiipgnddairsiqlilsravdliiqarggvvepspsyalvq
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1x18F (F:)
    arrrraevrqlqpdlvygdvlvtafinkimrdgkknlaarifydackiiqektgqeplkv
    fkqavenvkprmevrsrrvgganyqvpmevsrrqqslalrwlvqaanqrperraavriah
    elmdaaegkggavkkkedvermaeanrayahyrw
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1x18G (G:)
    krqvasgrayihasynntivtitdpdgnpitwssggvigykgsrkgtpyaaqlaaldaak
    kamaygmqsvdvivrgtgagreqairalqasglqvksivddtpvphngcrpkkkfrkas
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1x18H (H:)
    psrkakvkatlgefdlrdyrnvevlkrflsetgkilprrrtglsgkeqrilaktikrari
    lgllpfteklvrk
    

  • Chain 'X':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1x18X (X:)
    dksycgfiaivgrpnvgkstllnkllgqkisitsrkaqttrhrivgihtegayqaiyvdt
    pglhmeekrainrlmnkaasssigdvelvifvvegtrwtpddemvlnklregkapvilav
    nkvdnvqekadllphlqflasqmnfldivpisaetglnvdtiaaivrkhlpeathhfped
    yitdrsqrfmaseiireklmrflgaelpysvtveierfvsnerggydinglilveregqk
    kmvignkgakiktigiearkdmqemfeapvhlelwvkvksgwadderalrsl