PDB entry 1x0j

View 1x0j on RCSB PDB site
Description: Crystal structure analysis of the N-terminal bromodomain of human Brd2
Class: transcription
Keywords: alpha-helical domain, bromodomain, binds to acetylated histones, Structural Genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI, NPPSFA, National Project on Protein Structural and Functional Analyses, TRANSCRIPTION
Deposited on 2005-03-23, released 2006-06-27
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.178
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Bromodomain-containing protein 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P25440 (0-End)
      • modified residue (14)
      • modified residue (48)
      • modified residue (50)
      • modified residue (69)
      • modified residue (75)
      • modified residue (92)
      • modified residue (107)
    Domains in SCOPe 2.08: d1x0ja_
  • Chain 'B':
    Compound: Bromodomain-containing protein 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P25440 (0-End)
      • modified residue (14)
      • modified residue (48)
      • modified residue (50)
      • modified residue (69)
      • modified residue (75)
      • modified residue (92)
      • modified residue (107)
    Domains in SCOPe 2.08: d1x0jb_
  • Chain 'C':
    Compound: Bromodomain-containing protein 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P25440
      • modified residue (14)
      • modified residue (48)
      • modified residue (50)
      • modified residue (69)
      • modified residue (75)
      • modified residue (92)
      • modified residue (107)
    Domains in SCOPe 2.08: d1x0jc_
  • Heterogens: DTT, MES, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1x0jA (A:)
    grvtnqlqylhkvvmkalwkhqfawpfrqpvdavklglpdyhkiikqpmdmgtikrrlen
    nyywaasecmqdfntmftncyiynkptddivlmaqtlekiflqkvasmpqeeqelvvtip
    kn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1x0jA (A:)
    grvtnqlqylhkvvmkalwkhqfawpfrqpvdavklglpdyhkiikqpmdmgtikrrlen
    nyywaasecmqdfntmftncyiynkptddivlmaqtlekiflqkvasmpqeeqe
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1x0jB (B:)
    grvtnqlqylhkvvmkalwkhqfawpfrqpvdavklglpdyhkiikqpmdmgtikrrlen
    nyywaasecmqdfntmftncyiynkptddivlmaqtlekiflqkvasmpqeeqelvvtip
    kn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1x0jB (B:)
    grvtnqlqylhkvvmkalwkhqfawpfrqpvdavklglpdyhkiikqpmdmgtikrrlen
    nyywaasecmqdfntmftncyiynkptddivlmaqtlekiflqkvasmpqee
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1x0jC (C:)
    grvtnqlqylhkvvmkalwkhqfawpfrqpvdavklglpdyhkiikqpmdmgtikrrlen
    nyywaasecmqdfntmftncyiynkptddivlmaqtlekiflqkvasmpqeeqelvvtip
    kn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1x0jC (C:)
    tnqlqylhkvvmkalwkhqfawpfrqpvdavklglpdyhkiikqpmdmgtikrrlennyy
    waasecmqdfntmftncyiynkptddivlmaqtlekiflqkvasmpq