PDB entry 1wz1

View 1wz1 on RCSB PDB site
Description: Crystal structure of the Fv fragment complexed with dansyl-lysine
Class: immune system
Keywords: Antigen-antibody fragent complex, IMMUNE SYSTEM
Deposited on 2005-02-21, released 2006-01-31
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.216
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: Ig heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 1WZ1 (0-122)
    Domains in SCOPe 2.05: d1wz1h_
  • Chain 'L':
    Compound: Ig light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • GB AAB03598 (0-112)
      • see remark 999 (16)
      • see remark 999 (100)
      • see remark 999 (104)
    Domains in SCOPe 2.05: d1wz1l_
  • Heterogens: DNS

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1wz1H (H:)
evkleesggglvqpggsmklscatsgftfsdawmdwvrqspekglewvaeirnkannhat
yyaesvkgrftisrddskrrvylqmntlraedtgiyyctgiyyhypwfaywgqgtlvtvs
aep

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1wz1L (L:)
dvvmtqtplslpvslgnqasiscrssqslvhsngntylhwylqkpgqspklliykvsnrf
sgvpdrfsgsgsgtdftlkisrveaedlgvyfcsqsthvpftfgsgtkleikr