PDB entry 1wz1

View 1wz1 on RCSB PDB site
Description: Crystal structure of the Fv fragment complexed with dansyl-lysine
Class: immune system
Keywords: Antigen-antibody fragent complex
Deposited on 2005-02-21, released 2006-01-31
The last revision prior to the SCOP 1.75 freeze date was dated 2006-01-31, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.216
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: Ig heavy chain
    Species: MUS MUSCULUS
    Domains in SCOP 1.75: d1wz1h1
  • Chain 'L':
    Compound: Ig light chain
    Species: MUS MUSCULUS
    Database cross-references and differences (RAF-indexed):
    • GB AAB03598 (0-112)
      • see remark 999 (16)
      • see remark 999 (100)
      • see remark 999 (104)
    Domains in SCOP 1.75: d1wz1l1
  • Heterogens: DNS

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1wz1H (H:)
evkleesggglvqpggsmklscatsgftfsdawmdwvrqspekglewvaeirnkannhat
yyaesvkgrftisrddskrrvylqmntlraedtgiyyctgiyyhypwfaywgqgtlvtvs
aep

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1wz1L (L:)
dvvmtqtplslpvslgnqasiscrssqslvhsngntylhwylqkpgqspklliykvsnrf
sgvpdrfsgsgsgtdftlkisrveaedlgvyfcsqsthvpftfgsgtkleikr