PDB entry 1wyx

View 1wyx on RCSB PDB site
Description: The Crystal Structure of the p130Cas SH3 Domain at 1.1 A Resolution
Class: cell adhesion
Keywords: Beta sheets, CELL ADHESION
Deposited on 2005-02-17, released 2005-04-26
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.14 Å
R-factor: 0.177
AEROSPACI score: 0.86 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: CRK-associated substrate
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1wyxa_
  • Chain 'B':
    Compound: CRK-associated substrate
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1wyxb_
  • Heterogens: MG, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1wyxA (A:)
hlnvlakalydnvaespdelsfrkgdimtvleqdtqgldgwwlcslhgrqgivpgnrlki
lvgmydkkp

    Sequence, based on observed residues (ATOM records): (download) 
    >1wyxA (A:)
lnvlakalydnvaespdelsfrkgdimtvleqdtqgldgwwlcslhgrqgivpgnrlkil
vgmydkkp

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1wyxB (B:)
hlnvlakalydnvaespdelsfrkgdimtvleqdtqgldgwwlcslhgrqgivpgnrlki
lvgmydkkp