PDB entry 1wyp

View 1wyp on RCSB PDB site
Description: Solution structure of the CH domain of human Calponin 1
Class: structural protein
Keywords: CH domain, F-actin binding, all-alpha, structural genomics, NPPSFA, RIKEN Structural Genomics/Proteomics Initiative, RSGI, STRUCTURAL PROTEIN
Deposited on 2005-02-15, released 2005-08-15
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Calponin 1
  Species: Homo sapiens [TaxId:9606]
  Gene: CNN1
  Database cross-references and differences (RAF-indexed):
  • Uniprot P51911 (7-129)
    • cloning artifact (0-6)
    • cloning artifact (130-135)
  Domains in SCOPe 2.06: d1wypa1, d1wypa2, d1wypa3

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1wypA (A:)
  gssgssgnklaqkydhqreqelrewiegvtgrrignnfmdglkdgiilcefinklqpgsv
  kkinestqnwhqlenignfikaitkygvkphdifeandlfentnhtqvqstllalasmak
  tkgnkvnvgvsgpssg