PDB entry 1wyp

View 1wyp on RCSB PDB site
Description: Solution structure of the CH domain of human Calponin 1
Class: structural protein
Keywords: CH domain, F-actin binding, all-alpha, structural genomics, NPPSFA, RIKEN Structural Genomics/Proteomics Initiative, RSGI, STRUCTURAL PROTEIN
Deposited on 2005-02-15, released 2005-08-15
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Calponin 1
    Species: Homo sapiens [TaxId:9606]
    Gene: CNN1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P51911 (7-129)
      • cloning artifact (0-6)
      • cloning artifact (130-135)
    Domains in SCOPe 2.05: d1wypa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1wypA (A:)
    gssgssgnklaqkydhqreqelrewiegvtgrrignnfmdglkdgiilcefinklqpgsv
    kkinestqnwhqlenignfikaitkygvkphdifeandlfentnhtqvqstllalasmak
    tkgnkvnvgvsgpssg