PDB entry 1wyl

View 1wyl on RCSB PDB site
Description: Solution structure of the CH domain of human NEDD9 interacting protein with calponin homology and LIM domains
Class: signaling protein
Keywords: CH domain, MICAL, NEDD9, structural genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI, NPPSFA, National Project on Protein Structural and Functional Analyses, SIGNALING PROTEIN
Deposited on 2005-02-15, released 2005-08-15
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: NEDD9 interacting protein with calponin homology and LIM domains
  Species: Homo sapiens [TaxId:9606]
  Gene: NICAL
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q8TDZ2 (7-109)
    • cloning artifact (0-6)
    • cloning artifact (110-115)
  Domains in SCOPe 2.05: d1wyla_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1wylA (A:)
  gssgssgtqeellrwcqeqtagypgvhvsdlssswadglalcalvyrlqpgllepselqg
  lgaleatawalkvaenelgitpvvsaqavvagsdplgliaylshfhsafksgpssg