PDB entry 1wy8

View 1wy8 on RCSB PDB site
Description: Solution Structure of the N-terminal Ubiquitin-like Domain in Human Np95/ICBP90-like Ring Finger Protein (NIRF)
Class: ligase
Keywords: Ubiquitin-like domain, Np95/ICBP90-like ring finger (NIRF), ubiquitin ligase, Structural genomics, NPPSFA, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on 2005-02-09, released 2005-08-09
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Np95-like ring finger protein, isoform a
    Species: Homo sapiens [TaxId:9606]
    Gene: UHRF2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q96PU4 (7-82)
      • cloning artifact (0-6)
      • cloning artifact (83-88)
    Domains in SCOPe 2.03: d1wy8a1

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1wy8A (A:)
gssgssgmwiqvrtidgsktctiedvsrkatieelrervwalfdvrpecqrlfyrgkqle
ngytlfdydvglndiiqllvrpdsgpssg