PDB entry 1wxu

View 1wxu on RCSB PDB site
Description: Solution structure of the SH3 domain of mouse peroxisomal biogenesis factor 13
Class: protein transport
Keywords: SH3 domain, PEX13, protein-protein interaction, structural genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI, NPPSFA, National Project on Protein Structural and Functional Analyses, PROTEIN TRANSPORT
Deposited on 2005-02-01, released 2005-08-01
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: peroxisomal biogenesis factor 13
    Species: Mus musculus [TaxId:10090]
    Gene: Pex13
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8CCJ5 (7-86)
      • cloning artifact (0-6)
      • cloning artifact (87-92)
    Domains in SCOPe 2.06: d1wxua1, d1wxua2, d1wxua3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1wxuA (A:)
    gssgssgtnwasgeddhvvaraeydfvavsdeeisfragdmlnlalkeqqpkvrgwllas
    ldgqttglipanyvkilgkrrgrktiesgpssg