PDB entry 1wxs

View 1wxs on RCSB PDB site
Description: Solution Structure of Ufm1, a ubiquitin-fold modifier
Class: structural genomics, unknown function
Keywords: ubiquitin-fold, STRUCTURAL GENOMICS, UNKNOWN FUNCTION
Deposited on 2005-02-01, released 2006-04-18
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ubiquitin-fold Modifier 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P61960 (5-End)
      • cloning artifact (0-4)
    Domains in SCOPe 2.06: d1wxsa1, d1wxsa2

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1wxsA (A:)
    gplgsmskvsfkitltsdprlpykvlsvpestpftavlkfaaeefkvpaatsaiitndgi
    ginpaqtagnvflkhgselriiprdrvgsc
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wxsA (A:)
    gplgsmskvsfkitltsdprlpykvlsvpestpftavlkfaaeefkvpaatsaiitndgi
    ginpaqtagnvflkhgselriiprdrvg