PDB entry 1wx8

View 1wx8 on RCSB PDB site
Description: Solution Structure of the N-terminal Ubiquitin-like Domain in the 4931431F19Rik Protein
Class: structural genomics, unknown function
Keywords: Ubiquitin-like domain, Ubiquilin 1-like, Structural genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on 2005-01-20, released 2005-07-20
The last revision prior to the SCOP 1.73 freeze date was dated 2005-07-20, with a file datestamp of 2007-06-04.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: RIKEN cDNA 4931431F19
    Species: MUS MUSCULUS
    Gene: Riken cDNA 4931431F19
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9D4I8 (7-89)
      • cloning artifact (0-6)
      • cloning artifact (90-95)
    Domains in SCOP 1.73: d1wx8a1

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1wx8A (A:)
    gssgssgvsgrepssriirvsvktpqdchefflaensnvrrfkkqiskylhcnadrlvli
    ftgkilrdqdilsqrgildgstvhvvvrshsgpssg