PDB entry 1www

View 1www on RCSB PDB site
Description: ngf in complex with domain 5 of the trka receptor
Deposited on 1999-03-12, released 1999-09-15
The last revision prior to the SCOP 1.55 freeze date was dated 1999-09-15, with a file datestamp of 1999-09-14.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.189
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'V':
    Domains in SCOP 1.55: d1wwwv_
  • Chain 'W':
    Domains in SCOP 1.55: d1wwww_
  • Chain 'X':
    Domains in SCOP 1.55: d1wwwx_
  • Chain 'Y':
    Domains in SCOP 1.55: d1wwwy_

PDB Chain Sequences:

  • Chain 'V':
    Sequence, based on SEQRES records: (download)
    >1wwwV (V:)
    sshpifhrgefsvcdsvsvwvgdkttatdikgkevmvlgevninnsvfkqyffetkcrdp
    npvdsgcrgidskhwnsycttthtfvkaltmdgkqaawrfiridtacvcvlsrk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wwwV (V:)
    sshpifhrgefsvcdsvsvwvgdkttatdikgkevmvlgevninnsvfkqyffetkcrdg
    crgidskhwnsycttthtfvkaltmdgkqaawrfiridtacvcvlsrk
    

  • Chain 'W':
    Sequence, based on SEQRES records: (download)
    >1wwwW (W:)
    sshpifhrgefsvcdsvsvwvgdkttatdikgkevmvlgevninnsvfkqyffetkcrdp
    npvdsgcrgidskhwnsycttthtfvkaltmdgkqaawrfiridtacvcvlsrka
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wwwW (W:)
    sshpifhrgefsvcdsvsvwvgdkttatdikgkevmvlgevninnsvfkqyffetkcrdg
    crgidskhwnsycttthtfvkaltmdgkqaawrfiridtacvcvlsrka
    

  • Chain 'X':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1wwwX (X:)
    vsfpasvqlhtavemhhwcipfsvdgqpapslrwlfngsvlnetsfifteflepaanetv
    rhgclrlnqpthvnngnytllaanpfgqasasimaafmdnp
    

  • Chain 'Y':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1wwwY (Y:)
    vsfpasvqlhtavemhhwcipfsvdgqpapslrwlfngsvlnetsfifteflepaanetv
    rhgclrlnqpthvnngnytllaanpfgqasasimaafmdnp