PDB entry 1www

View 1www on RCSB PDB site
Description: ngf in complex with domain 5 of the trka receptor
Class: nerve growth factor/trka complex
Keywords: complex, trka receptor, nerve growth factor, cysteine knot, immunoglobulin like domain, nerve growth factor/trka complex complex
Deposited on 1999-03-12, released 1999-09-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.189
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'V':
    Compound: protein (nerve growth factor)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1wwwv_
  • Chain 'W':
    Compound: protein (nerve growth factor)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1wwww_
  • Chain 'X':
    Compound: protein (trka receptor)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1wwwx_
  • Chain 'Y':
    Compound: protein (trka receptor)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1wwwy_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'V':
    Sequence, based on SEQRES records: (download)
    >1wwwV (V:)
    ssshpifhrgefsvcdsvsvwvgdkttatdikgkevmvlgevninnsvfkqyffetkcrd
    pnpvdsgcrgidskhwnsycttthtfvkaltmdgkqaawrfiridtacvcvlsrkavrra
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wwwV (V:)
    sshpifhrgefsvcdsvsvwvgdkttatdikgkevmvlgevninnsvfkqyffetkcrdg
    crgidskhwnsycttthtfvkaltmdgkqaawrfiridtacvcvlsrk
    

  • Chain 'W':
    Sequence, based on SEQRES records: (download)
    >1wwwW (W:)
    ssshpifhrgefsvcdsvsvwvgdkttatdikgkevmvlgevninnsvfkqyffetkcrd
    pnpvdsgcrgidskhwnsycttthtfvkaltmdgkqaawrfiridtacvcvlsrkavrra
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wwwW (W:)
    sshpifhrgefsvcdsvsvwvgdkttatdikgkevmvlgevninnsvfkqyffetkcrdg
    crgidskhwnsycttthtfvkaltmdgkqaawrfiridtacvcvlsrka
    

  • Chain 'X':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1wwwX (X:)
    vsfpasvqlhtavemhhwcipfsvdgqpapslrwlfngsvlnetsfifteflepaanetv
    rhgclrlnqpthvnngnytllaanpfgqasasimaafmdnp
    

  • Chain 'Y':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1wwwY (Y:)
    vsfpasvqlhtavemhhwcipfsvdgqpapslrwlfngsvlnetsfifteflepaanetv
    rhgclrlnqpthvnngnytllaanpfgqasasimaafmdnp