PDB entry 1wwc

View 1wwc on RCSB PDB site
Description: nt3 binding domain of human trkc receptor
Deposited on 1999-04-30, released 1999-07-07
The last revision prior to the SCOP 1.57 freeze date was dated 1999-07-07, with a file datestamp of 1999-07-06.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.187
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.57: d1wwca_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1wwcA (A:)
tvyypprvvsleepelrlehciefvvrgnppptlhwlhngqplreskiihveyyqegeis
egcllfnkpthynngnytliaknplgtanqtinghflkepfpvde