PDB entry 1wwb

View 1wwb on RCSB PDB site
Description: ligand binding domain of human trkb receptor
Deposited on 1999-05-03, released 1999-07-07
The last revision prior to the SCOP 1.57 freeze date was dated 1999-08-17, with a file datestamp of 1999-08-16.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.247
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'X':
    Domains in SCOP 1.57: d1wwbx_

PDB Chain Sequences:

  • Chain 'X':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1wwbX (X:)
vhfaptitflesptsdhhwcipftvkgnpkpalqwfyngailneskyictkihvtnhtey
hgclqldnpthmnngdytliakneygkdekqisahfmgwpgid