PDB entry 1wwa

View 1wwa on RCSB PDB site
Description: ngf binding domain of human trka receptor
Deposited on 1999-04-29, released 1999-07-07
The last revision prior to the SCOP 1.57 freeze date was dated 1999-07-07, with a file datestamp of 1999-07-06.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.207
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'X':
    Domains in SCOP 1.57: d1wwax_
  • Chain 'Y':
    Domains in SCOP 1.57: d1wway_

PDB Chain Sequences:

  • Chain 'X':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1wwaX (X:)
vsfpasvqlhtavemhhwcipfsvdgqpapslrwlfngsvlnetsfifteflepaanetv
rhgclrlnqpthvnngnytllaanpfgqasasimaafmdnpfefn

  • Chain 'Y':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1wwaY (Y:)
vqvnvsfpasvqlhtavemhhwcipfsvdgqpapslrwlfngsvlnetsfifteflepaa
netvrhgclrlnqpthvnngnytllaanpfgqasasimaafmdnp