PDB entry 1wvb

View 1wvb on RCSB PDB site
Description: Crystal structure of human arginase I: the mutant E256Q
Class: Hydrolase
Keywords: Hydrolase, TWINNED CRYSTAL, MUTANT E256Q
Deposited on 2004-12-14, released 2005-09-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-07-16, with a file datestamp of 2014-07-11.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.154
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: arginase 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05089
      • engineered (255)
    Domains in SCOPe 2.07: d1wvba1
  • Chain 'B':
    Compound: arginase 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05089
      • engineered (255)
    Domains in SCOPe 2.07: d1wvbb_
  • Heterogens: MN, S2C, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1wvbA (A:)
    msaksrtigiigapfskgqprggveegptvlrkaglleklkeqecdvkdygdlpfadipn
    dspfqivknprsvgkaseqlagkvaevkkngrislvlggdhslaigsisgharvhpdlgv
    iwvdahtdintpltttsgnlhgqpvsfllkelkgkipdvpgfswvtpcisakdivyiglr
    dvdpgehyilktlgikyfsmtevdrlgigkvmeetlsyllgrkkrpihlsfdvdgldpsf
    tpatgtpvvggltyrqglyiteeiyktgllsgldimevnpslgktpeevtrtvntavait
    lacfglaregnhkpidylnppk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wvbA (A:)
    srtigiigapfskgqprggveegptvlrkaglleklkeqecdvkdygdlpfadipndspf
    qivknprsvgkaseqlagkvaevkkngrislvlggdhslaigsisgharvhpdlgviwvd
    ahtdintpltttsgnlhgqpvsfllkelkgkipdvpgfswvtpcisakdivyiglrdvdp
    gehyilktlgikyfsmtevdrlgigkvmeetlsyllgrkkrpihlsfdvdgldpsftpat
    gtpvvggltyrqglyiteeiyktgllsgldimevnpslgktpeevtrtvntavaitlacf
    glaregnhk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1wvbB (B:)
    msaksrtigiigapfskgqprggveegptvlrkaglleklkeqecdvkdygdlpfadipn
    dspfqivknprsvgkaseqlagkvaevkkngrislvlggdhslaigsisgharvhpdlgv
    iwvdahtdintpltttsgnlhgqpvsfllkelkgkipdvpgfswvtpcisakdivyiglr
    dvdpgehyilktlgikyfsmtevdrlgigkvmeetlsyllgrkkrpihlsfdvdgldpsf
    tpatgtpvvggltyrqglyiteeiyktgllsgldimevnpslgktpeevtrtvntavait
    lacfglaregnhkpidylnppk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wvbB (B:)
    srtigiigapfskgqprggveegptvlrkaglleklkeqecdvkdygdlpfadipndspf
    qivknprsvgkaseqlagkvaevkkngrislvlggdhslaigsisgharvhpdlgviwvd
    ahtdintpltttsgnlhgqpvsfllkelkgkipdvpgfswvtpcisakdivyiglrdvdp
    gehyilktlgikyfsmtevdrlgigkvmeetlsyllgrkkrpihlsfdvdgldpsftpat
    gtpvvggltyrqglyiteeiyktgllsgldimevnpslgktpeevtrtvntavaitlacf
    glaregnhk