PDB entry 1wum

View 1wum on RCSB PDB site
Description: Complex structure of PCAF bromodomain with small chemical ligand NP2
Class: transferase
Keywords: bromodomain, histone-acetyltransferase, nmr-structure, chemical ligand, np2, np1
Deposited on 2004-12-08, released 2005-08-16
The last revision prior to the SCOP 1.73 freeze date was dated 2005-08-16, with a file datestamp of 2007-06-04.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Histone acetylatransferase PCAF
  Species: HOMO SAPIENS
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q92831 (4-117)
    • his tag (0-3)
    • conflict (89-90)
  Domains in SCOP 1.73: d1wuma1
• Heterogens: NP2

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1wumA (A:)
  gshmskeprdpdqlystlksilqqvkshqsawpfmepvkrteapgyyevirfpmdlktms
  erlknryyvskklfmadlqrvftnckeynppeseyykcanilekfffskikeaglidk