PDB entry 1wug

View 1wug on RCSB PDB site
Description: complex structure of PCAF bromodomain with small chemical ligand NP1
Class: transferase
Keywords: bromodomain, histone-acetyltransferase, nmr-structure, chemical ligand
Deposited on 2004-12-07, released 2005-08-16
The last revision prior to the SCOP 1.75 freeze date was dated 2005-08-16, with a file datestamp of 2007-06-04.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Histone acetylatransferase PCAF
    Species: HOMO SAPIENS
    Gene: PCAF
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q92831 (4-117)
      • his tag (0-3)
      • conflict (89-90)
    Domains in SCOP 1.75: d1wuga1
  • Heterogens: NP1

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1wugA (A:)
gshmskeprdpdqlystlksilqqvkshqsawpfmepvkrteapgyyevirfpmdlktms
erlknryyvskklfmadlqrvftnckeynppeseyykcanilekfffskikeaglidk