PDB entry 1wry

View 1wry on RCSB PDB site
Description: Solution structure of the SH3 domain-binding glutamic acid-rich-like protein
Class: structural genomics, unknown function
Keywords: SH3BGR like protein, structural genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI, UNKNOWN FUNCTION
Deposited on 2004-10-29, released 2005-04-29
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: SH3 domain-binding glutamic acid-rich-like protein
  Species: Homo sapiens [TaxId:9606]
  Gene: IMS cDNA STM03594
  Database cross-references and differences (RAF-indexed):
  • Uniprot O75368 (7-114)
    • cloning artifact (0-6)
    • cloning artifact (115-120)
  Domains in SCOPe 2.08: d1wrya1, d1wrya2, d1wrya3

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1wryA (A:)
  gssgssgmvirvyiasssgstaikkkqqdvlgfleankigfeekdiaaneenrkwmrenv
  pensrpatgyplppqifnesqyrgdydaffearennavyaflgltappgskeaevsgpss
  g