PDB entry 1wrv

View 1wrv on RCSB PDB site
Description: Crystal Structure of T.th.HB8 Branched-Chain Amino Acid Aminotransferase
Class: transferase
Keywords: hexamer, PLP-dependent enzyme, Structural Genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI, TRANSFERASE
Deposited on 2004-10-27, released 2005-10-18
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.205
AEROSPACI score: 0.61 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: branched-chain amino acid aminotransferase
    Species: Thermus thermophilus [TaxId:274]
    Gene: HB8
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1wrva_
  • Chain 'B':
    Compound: branched-chain amino acid aminotransferase
    Species: Thermus thermophilus [TaxId:274]
    Gene: HB8
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1wrvb_
  • Chain 'C':
    Compound: branched-chain amino acid aminotransferase
    Species: Thermus thermophilus [TaxId:274]
    Gene: HB8
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1wrvc_
  • Heterogens: CL, PLP, MPD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1wrvA (A:)
    mqikagliwmngafvpqeeaktsvlshalhygtsvfegirayetakgpaifrlkehvkrf
    ynsakvlrmeipfapeeleeaikevvrrngyrscyirplawmgakalgvnplpnnpaevm
    vaawewgaylgeeavrkgarlitsswarfpanvmpgkakvggnyvnsalakmeavaagad
    eallldeegyvaegsgenlffvrdgviyalehsvnlegitrdsviriakdlgyevqvvra
    trdqlymadevfmtgtaaevtpvsmidwrpigkgtagpvalrlrevyleavtgrrpeyeg
    wltyvngq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wrvA (A:)
    qikagliwmngafvpqeeaktsvlshalhygtsvfegirayetakgpaifrlkehvkrfy
    nsakvlrmeipfapeeleeaikevvrrngyrscyirplawmgakalgvnplpnnpaevmv
    aawewvrkgarlitsswarfpanvmpgkakvggnyvnsalakmeavaagadeallldeeg
    yvaegsgenlffvrdgviyalehsvnlegitrdsviriakdlgyevqvvratrdqlymad
    evfmtgtaaevtpvsmidwrpigkgtagpvalrlrevyleavtgrrpeyegwltyvn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1wrvB (B:)
    mqikagliwmngafvpqeeaktsvlshalhygtsvfegirayetakgpaifrlkehvkrf
    ynsakvlrmeipfapeeleeaikevvrrngyrscyirplawmgakalgvnplpnnpaevm
    vaawewgaylgeeavrkgarlitsswarfpanvmpgkakvggnyvnsalakmeavaagad
    eallldeegyvaegsgenlffvrdgviyalehsvnlegitrdsviriakdlgyevqvvra
    trdqlymadevfmtgtaaevtpvsmidwrpigkgtagpvalrlrevyleavtgrrpeyeg
    wltyvngq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wrvB (B:)
    qikagliwmngafvpqeeaktsvlshalhygtsvfegirayetakgpaifrlkehvkrfy
    nsakvlrmeipfapeeleeaikevvrrngyrscyirplawmgakalgvnplpnnpaevmv
    aawewgaylgeeavrkgarlitsswarfpanvmpgkakvggnyvnsalakmeavaagade
    allldeegyvaegsgenlffvrdgviyalehsvnlegitrdsviriakdlgyevqvvrat
    rdqlymadevfmtgtaaevtpvsmidwrpigkgtagpvalrlrevyleavtgrrpeyegw
    ltyvn
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1wrvC (C:)
    mqikagliwmngafvpqeeaktsvlshalhygtsvfegirayetakgpaifrlkehvkrf
    ynsakvlrmeipfapeeleeaikevvrrngyrscyirplawmgakalgvnplpnnpaevm
    vaawewgaylgeeavrkgarlitsswarfpanvmpgkakvggnyvnsalakmeavaagad
    eallldeegyvaegsgenlffvrdgviyalehsvnlegitrdsviriakdlgyevqvvra
    trdqlymadevfmtgtaaevtpvsmidwrpigkgtagpvalrlrevyleavtgrrpeyeg
    wltyvngq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wrvC (C:)
    qikagliwmngafvpqeeaktsvlshalhygtsvfegirayetakgpaifrlkehvkrfy
    nsakvlrmeipfapeeleeaikevvrrngyrscyirplawmgakalgvnplpnnpaevmv
    aawewkgarlitsswarfpanvmpgkakvggnyvnsalakmeavaagadeallldeegyv
    aegsgenlffvrdgviyalehsvnlegitrdsviriakdlgyevqvvratrdqlymadev
    fmtgtaaevtpvsmidwrpigkgtagpvalrlrevyleavtgrrpeyegwltyvn