PDB entry 1wri

View 1wri on RCSB PDB site
Description: Crystal Structure of Ferredoxin isoform II from E. arvense
Class: Electron transport
Keywords: Electron transport
Deposited on 2004-10-18, released 2004-11-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.2 Å
R-factor: 0.118
AEROSPACI score: 0.86 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ferredoxin II
    Species: Equisetum arvense [TaxId:3258]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1wria_
  • Heterogens: FES, BEN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1wriA (A:)
    aykvtlktpdgditfdvepgerlidigsekadlplscqagacstclgkivsgtvdqsegs
    flddeqieqgyvltciaipesdvviethkedel