PDB entry 1wr1

View 1wr1 on RCSB PDB site
Description: The complex sturcture of Dsk2p UBA with ubiquitin
Class: signaling protein
Keywords: uba domain, uba-ubiquitin complex, dsk2
Deposited on 2004-10-08, released 2005-04-19
The last revision prior to the SCOP 1.75 freeze date was dated 2005-04-19, with a file datestamp of 2007-06-04.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.1 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ubiquitin
    Species: Saccharomyces cerevisiae
    Gene: UBI4 (1224-1451)
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1wr1a1
  • Chain 'B':
    Compound: ubiquitin-like protein dsk2
    Species: Saccharomyces cerevisiae
    Gene: DSK2 (982-1120)
    Database cross-references and differences (RAF-indexed):
    • Uniprot P48510 (12-57)
      • cloning artifact (0-11)
    Domains in SCOP 1.75: d1wr1b1

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1wr1A (A:)
    mqifvktltgktitlevessdtidnvkskiqdkegippdqqrlifagkqledgrtlsdyn
    iqkestlhlvlrlrgg
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1wr1B (B:)
    pgisgggggildpeeryehqlrqlndmgffdfdrnvaalrrsggsvqgaldsllngdv