PDB entry 1wqq

View 1wqq on RCSB PDB site
Description: contribution of hydrogen bonds to the conformational stability of human lysozyme
Class: hydrolase
Keywords: hydrolase (o-glycosyl), glycosidase, bacteriolytic enzyme
Deposited on 1998-02-09, released 1998-07-01
The last revision prior to the SCOP 1.73 freeze date was dated 1998-07-01, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.164
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: lysozyme
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed):
    • Uniprot P61626 (0-129)
      • engineered (53)
    Domains in SCOP 1.73: d1wqqa_
  • Heterogens: NA, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1wqqA (A:)
    kvfercelartlkrlgmdgyrgislanwmclakwesgyntratnynagdrstdfgifqin
    srywcndgktpgavnachlscsallqdniadavacakrvvrdpqgirawvawrnrcqnrd
    vrqyvqgcgv