PDB entry 1wqq

View 1wqq on RCSB PDB site
Description: contribution of hydrogen bonds to the conformational stability of human lysozyme
Deposited on 1998-02-09, released 1998-07-01
The last revision prior to the SCOP 1.57 freeze date was dated 1998-07-01, with a file datestamp of 1998-07-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.164
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.57: d1wqq__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1wqq_ (-)
    kvfercelartlkrlgmdgyrgislanwmclakwesgyntratnynagdrstdfgifqin
    srywcndgktpgavnachlscsallqdniadavacakrvvrdpqgirawvawrnrcqnrd
    vrqyvqgcgv