PDB entry 1wqh

View 1wqh on RCSB PDB site
Description: Crystal structure of ribosome recycling factor from Mycobacterium tuberculosis
Class: translation
Keywords: Translation factor, triple-HELIX bundle, protein synthesis
Deposited on 2004-09-29, released 2005-02-22
The last revision prior to the SCOP 1.75 freeze date was dated 2005-02-22, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.226
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ribosome recycling factor
    Species: Mycobacterium tuberculosis
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1wqha1
  • Heterogens: CD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1wqhA (A:)
    midealfdaeekmekavavarddlstirtgranpgmfsritidyygaatpitqlasinvp
    earlvvikpyeanqlraietairnsdlgvnptndgalirvavpqlteerrrelvkqakhk
    geeakvsvrnirrkameelhrirkegeagedevgraekdldktthqyvtqidelvkhkeg
    ellev
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wqhA (A:)
    idealfdaeekmekavavarddlstirtgranpgmfsritidyygaatpitqlasinvpe
    arlvvikpyeanqlraietairnsdlgvnptndgalirvavpqlteerrrelvkqakhkg
    eeakvsvrnirrkameelhrirkegeagedevgraekdldktthqyvtqidelvkhkege
    lle